PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G2244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 230aa    MW: 26315.8 Da    PI: 8.8476
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G2244genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++  G g+W++ ++  g+ R++k+c++rw +yl
      Gh_D02G2244 14 KGAWTKEEDDRLIAYIRARGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.76.5e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Edel+++++ +lG++ W++Ia++++ gRt++++k++w+++
      Gh_D02G2244  67 RGNFTEDEDELIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.548961IPR017930Myb domain
SMARTSM007179.3E-111363IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-2813108IPR009057Homeodomain-like
PfamPF002492.5E-131461IPR001005SANT/Myb domain
CDDcd001675.98E-81661No hitNo description
PROSITE profilePS5129429.2962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2865116IPR009057Homeodomain-like
SMARTSM007175.3E-1866114IPR001005SANT/Myb domain
PfamPF002492.3E-1767111IPR001005SANT/Myb domain
CDDcd001671.09E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLIAYIR ARGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEDEDELIIK LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIRRKLLNRG  120
VDPLTHKQLN ESTGRHVASA ICCNGVNYEG NKEDSNYDIK NPNEFINKDD DDEMKKIPDL  180
NLDLRISPPT EPIMSSSMNK SKSKSKNNGN GYDFLGLESG FLDFRSLEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.143331e-119boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2348751e-114HQ234875.1 Gossypium hirsutum MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480467.11e-152PREDICTED: myb-related protein 308-like
SwissprotP813933e-98MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0B0MLW61e-152A0A0B0MLW6_G
STRINGVIT_03s0038g02310.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-92myb domain protein 4